PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 191aa    MW: 20923.7 Da    PI: 6.3695
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01685.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF25.81.4e-08955450
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +n+ +r  +f kRr +++  A+ LS   +a vavi fs+ g+ + ++
  Pahal.D01685.1  9 DNEDQRRHSFRKRRPTLFGMAHDLSEEFGAHVAVIAFSPAGEPHAFC 55
                    78999999*********************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0015157IPR002100Transcription factor, MADS-box
CDDcd001201.25E-11457No hitNo description
PROSITE profilePS5006612.531458IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-13468IPR002100Transcription factor, MADS-box
PfamPF003191.8E-121054IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAKELRPFDN EDQRRHSFRK RRPTLFGMAH DLSEEFGAHV AVIAFSPAGE PHAFCAPTAD  60
SVLRTYLPAA DGLLPNPTPH SPFPGSAAGV GAETAGEAAA RVAGMRREVD ETKAMVAEEW  120
ARVAAAREKV RAAQGAAQKQ NWWEVDVEAL GEEELPVFMR ALEMFKAEVQ ERIDAMASAR  180
MSLPREKKRQ *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438447.13e-77hypothetical protein SORBIDRAFT_10g019790
TrEMBLC5Z3H04e-77C5Z3H0_SORBI; Putative uncharacterized protein Sb10g019790
STRINGSb10g019790.11e-76(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7989512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-09AGAMOUS-like 61